Lineage for d1qhab2 (1qha B:223-465)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316780Family c.55.1.3: Hexokinase [53083] (2 proteins)
  6. 316788Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 316789Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 316799Domain d1qhab2: 1qha B:223-465 [33472]

Details for d1qhab2

PDB Entry: 1qha (more details), 2.25 Å

PDB Description: human hexokinase type i complexed with atp analogue amp-pnp

SCOP Domain Sequences for d1qhab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhab2 c.55.1.3 (B:223-465) Mammalian type I hexokinase {Human (Homo sapiens)}
hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreid
rgslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai
eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr
lae

SCOP Domain Coordinates for d1qhab2:

Click to download the PDB-style file with coordinates for d1qhab2.
(The format of our PDB-style files is described here.)

Timeline for d1qhab2: