Lineage for d1qhaa4 (1qha A:671-914)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 245988Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 246145Family c.55.1.3: Hexokinase [53083] (2 proteins)
  6. 246153Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 246154Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 246162Domain d1qhaa4: 1qha A:671-914 [33470]

Details for d1qhaa4

PDB Entry: 1qha (more details), 2.25 Å

PDB Description: human hexokinase type i complexed with atp analogue amp-pnp

SCOP Domain Sequences for d1qhaa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhaa4 c.55.1.3 (A:671-914) Mammalian type I hexokinase {Human (Homo sapiens)}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvn
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrte

SCOP Domain Coordinates for d1qhaa4:

Click to download the PDB-style file with coordinates for d1qhaa4.
(The format of our PDB-style files is described here.)

Timeline for d1qhaa4: