![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries) |
![]() | Domain d1qhaa3: 1qha A:466-670 [33469] complexed with anp, g6p, glc, mg |
PDB Entry: 1qha (more details), 2.25 Å
SCOPe Domain Sequences for d1qhaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhaa3 c.55.1.3 (A:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} qhrqieetlahfhltkdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgten gdflaldlggtnfrvllvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdf ldymgikgprmplgftfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrre efdldvvavvndtvgtmmtcayeep
Timeline for d1qhaa3:
![]() Domains from other chains: (mouse over for more information) d1qhab1, d1qhab2, d1qhab3, d1qhab4 |