SCOP 1.65: Domain d1czan3: 1cza N:466-670

Lineage for d1czan3 (1cza N:466-670)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (2 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)

8. Domain d1czan3: 1cza N:466-670 [33465]

Details for d1czan3

PDB Entry: 1cza, 1.9 Å

PDB Description: mutant monomer of recombinant human hexokinase type i complexed with glucose, glucose-6-phosphate, and adp

SCOP Domain Sequences for d1czan3:

Sequence; same for both SEQRES and ATOM records:

>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens)}
qhrqieetlahfhltkdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgten
gdflaldlggtnfrvllvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdf
ldymgikgprmplgftfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrre
efdldvvavvndtvgtmmtcayeep

Timeline for d1czan3:

• d1czan3 first appeared (with stable ids) in SCOP 1.55
  
• d1czan3 appears in SCOP 1.63
  
• d1czan3 appears in SCOP 1.67
  
• d1czan3 appears in the current release, SCOPe 2.08