SCOPe 2.07: Domain d5ueza1: 5uez A:352-457

Lineage for d5ueza1 (5uez A:352-457)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5ueza1: 5uez A:352-457 [334626]
   Other proteins in same PDB: d5ueza2
   automated match to d2ouoa_
   complexed with 89g

Details for d5ueza1

PDB Entry: 5uez, 1.51 Å

PDB Description: brd4_bd2_a-1342843

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5ueza1:

Sequence; same for both SEQRES and ATOM records:

>d5ueza1 a.29.2.0 (A:352-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskleare
yrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm

Timeline for d5ueza1:

• d5ueza1 first appeared in SCOPe 2.06
  
• d5ueza1 appears in the current release, SCOPe 2.08