![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.2: Acetokinase-like [53080] (3 proteins) |
![]() | Protein Acetate kinase [53081] (1 species) |
![]() | Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries) Uniprot P38502 1-399 |
![]() | Domain d1g99a2: 1g99 A:198-398 [33458] complexed with adp, so4 |
PDB Entry: 1g99 (more details), 2.5 Å
SCOPe Domain Sequences for d1g99a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g99a2 c.55.1.2 (A:198-398) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]} paeetkiitchlgngssitaveggksvetsmgftpleglamgtrcgsidpaivpflmeke glttreidtlmnkksgvlgvsglsndfrdldeaaskgnrkaelaleifaykvkkfigeys avlngadavvftagigensasirkriltgldgigikiddeknkirgqeidistpdakvrv fviptneelaiaretkeivet
Timeline for d1g99a2: