Lineage for d1g99a1 (1g99 A:1-197)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492018Family c.55.1.2: Acetokinase-like [53080] (4 proteins)
  6. 2492019Protein Acetate kinase [53081] (1 species)
  7. 2492020Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries)
    Uniprot P38502 1-399
  8. 2492021Domain d1g99a1: 1g99 A:1-197 [33457]
    complexed with adp, so4

Details for d1g99a1

PDB Entry: 1g99 (more details), 2.5 Å

PDB Description: an ancient enzyme: acetate kinase from methanosarcina thermophila
PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d1g99a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g99a1 c.55.1.2 (A:1-197) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]}
mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
gtshkyvaeraalmlgk

SCOPe Domain Coordinates for d1g99a1:

Click to download the PDB-style file with coordinates for d1g99a1.
(The format of our PDB-style files is described here.)

Timeline for d1g99a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g99a2