Lineage for d1e4ft2 (1e4f T:200-390)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122303Protein Cell division protein FtsA [53078] (1 species)
  7. 2122304Species Thermotoga maritima [TaxId:2336] [53079] (3 PDB entries)
  8. 2122308Domain d1e4ft2: 1e4f T:200-390 [33454]
    CASP4

Details for d1e4ft2

PDB Entry: 1e4f (more details), 1.9 Å

PDB Description: ftsa (apo form) from thermotoga maritima
PDB Compounds: (T:) cell division protein ftsa

SCOPe Domain Sequences for d1e4ft2:

Sequence, based on SEQRES records: (download)

>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
ttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvsavldtsfeeserl
iithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreimskskkffreveak
iveegeigipggvvltgggakiprinelatevfkspvrtgcyansdrpsiinadevandp
sfaaafgnvfa

Sequence, based on observed residues (ATOM records): (download)

>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
ttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvsavldtsfeeserl
iithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreimskskkffreveak
igipggvvltgggakiprinelatevfkspvrtgcyansdrpsiinadevandpsfaaaf
gnvfa

SCOPe Domain Coordinates for d1e4ft2:

Click to download the PDB-style file with coordinates for d1e4ft2.
(The format of our PDB-style files is described here.)

Timeline for d1e4ft2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ft1