PDB entry 1e4f

View 1e4f on RCSB PDB site
Description: ftsa (apo form) from thermotoga maritima
Class: bacterial cell division
Keywords: bacterial cell division, actin family
Deposited on 2000-07-03, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Compound: cell division protein ftsa
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FTSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e4ft1, d1e4ft2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1e4fT (T:)
    midlsktvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesv
    ntllkeleeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqseale
    klkengktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdt
    vkspfqlksslvstaegvlttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkh
    vikdvsavldtsfeeserliithgnavyndlkeeeiqyrgldgntiktttakklsviiha
    rlreimskskkffreveakiveegeigipggvvltgggakiprinelatevfkspvrtgc
    yansdrpsiinadevandpsfaaafgnvfavsenpyeetpvksenplkkifrlfkelme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4fT (T:)
    tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
    leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
    ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
    lksslvstaegvlttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvs
    avldtsfeeserliithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreim
    skskkffreveakigipggvvltgggakiprinelatevfkspvrtgcyansdrpsiina
    devandpsfaaafgnvfa