SCOPe 2.01: Domain d1e4ft1: 1e4f T:7-199

Lineage for d1e4ft1 (1e4f T:7-199)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Cell division protein FtsA [53078] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [53079] (2 PDB entries)

8. Domain d1e4ft1: 1e4f T:7-199 [33453]
   CASP4

Details for d1e4ft1

PDB Entry: 1e4f, 1.9 Å

PDB Description: ftsa (apo form) from thermotoga maritima

PDB Compounds: (T:) cell division protein ftsa

SCOPe Domain Sequences for d1e4ft1:

Sequence; same for both SEQRES and ATOM records:

>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
lksslvstaegvl

Timeline for d1e4ft1:

• d1e4ft1 first appeared (with stable ids) in SCOP 1.55
  
• d1e4ft1 appears in SCOP 1.75
  
• d1e4ft1 appears in SCOPe 2.02
  
• d1e4ft1 appears in the current release, SCOPe 2.08