Lineage for d1yvna2 (1yvn A:147-375)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605038Protein Actin [53073] (7 species)
  7. 1605039Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries)
  8. 1605043Domain d1yvna2: 1yvn A:147-375 [33452]
    Other proteins in same PDB: d1yvng_
    complexed with atp, ca, mg, so4; mutant

Details for d1yvna2

PDB Entry: 1yvn (more details), 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.
PDB Compounds: (A:) protein (actin)

SCOPe Domain Sequences for d1yvna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvna2 c.55.1.1 (A:147-375) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rttgivldsgdgnthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkcf

SCOPe Domain Coordinates for d1yvna2:

Click to download the PDB-style file with coordinates for d1yvna2.
(The format of our PDB-style files is described here.)

Timeline for d1yvna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvna1
View in 3D
Domains from other chains:
(mouse over for more information)
d1yvng_