Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Ochrobactrum anthropi [TaxId:439375] [334452] (2 PDB entries) |
Domain d5ghfb_: 5ghf B: [334492] automated match to d4e3qa_ complexed with pmp |
PDB Entry: 5ghf (more details), 2 Å
SCOPe Domain Sequences for d5ghfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ghfb_ c.67.1.0 (B:) automated matches {Ochrobactrum anthropi [TaxId: 439375]} lviergdgiyvedvsgkryieamsglwsvgvgfseprlaeaaarqmkklpfyhtfsyrsh gpvidlaeklvsmapvpmskayftnsgseandtvvkliwyrsnalgeperkkiisrkrgy hgvtiasasltglpnnhrsfdlpidrilhtgcphfyregqageseeqfatrladeleqli iaegphtiaafigepvmgaggvvvppktywekvqavlkrydilliadevicgfgrtgnlf gsqtfdmkpdilvmskqlsssylpisaflinervyapiaeeshkigtlgtgftasghpva aavalenlaiieerdlvanardrgtymqkrlrelqdhplvgevrgvgliagvelvtdkqa ktgleptgalgakanavlqergvisramgdtlafcppliindqqvdtmvsaleatlndvq aslt
Timeline for d5ghfb_: