PDB entry 5ghf

View 5ghf on RCSB PDB site
Description: Transaminase with L-ala
Class: transferase
Keywords: Transaminase, PMP, TRANSFERASE
Deposited on 2016-06-19, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase class-III
    Species: Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) [TaxId:439375]
    Gene: Oant_0199
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghfa_
  • Chain 'B':
    Compound: Aminotransferase class-III
    Species: Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) [TaxId:439375]
    Gene: Oant_0199
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghfb_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ghfA (A:)
    mtaqpnsleardiryhlhsytdavrleaegplviergdgiyvedvsgkryieamsglwsv
    gvgfseprlaeaaarqmkklpfyhtfsyrshgpvidlaeklvsmapvpmskayftnsgse
    andtvvkliwyrsnalgeperkkiisrkrgyhgvtiasasltglpnnhrsfdlpidrilh
    tgcphfyregqageseeqfatrladeleqliiaegphtiaafigepvmgaggvvvppkty
    wekvqavlkrydilliadevicgfgrtgnlfgsqtfdmkpdilvmskqlsssylpisafl
    inervyapiaeeshkigtlgtgftasghpvaaavalenlaiieerdlvanardrgtymqk
    rlrelqdhplvgevrgvgliagvelvtdkqaktgleptgalgakanavlqergvisramg
    dtlafcppliindqqvdtmvsaleatlndvqasltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ghfA (A:)
    qpnsleardiryhlhsytdavrleaegplviergdgiyvedvsgkryieamsglwsvgvg
    fseprlaeaaarqmkklpfyhgpvidlaeklvsmapvpmskayftnsgseandtvvkliw
    yrsnalgeperkkiisrkrgyhgvtiasasltglpnnhrsfdlpidrilhtgcphfyreg
    qageseeqfatrladeleqliiaegphtiaafigepvmgaggvvvppktywekvqavlkr
    ydilliadevicgfgrtgnlfgsqtfdmkpdilvmskqlsssylpisaflinervyapia
    sghpvaaavalenlaiieerdlvanardrgtymqkrlrelqdhplvgevrgvgliagvel
    vtdkqaktgleptgalgakanavlqergvisramgdtlafcppliindqqvdtmvsalea
    tlndvqasltr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ghfB (B:)
    mtaqpnsleardiryhlhsytdavrleaegplviergdgiyvedvsgkryieamsglwsv
    gvgfseprlaeaaarqmkklpfyhtfsyrshgpvidlaeklvsmapvpmskayftnsgse
    andtvvkliwyrsnalgeperkkiisrkrgyhgvtiasasltglpnnhrsfdlpidrilh
    tgcphfyregqageseeqfatrladeleqliiaegphtiaafigepvmgaggvvvppkty
    wekvqavlkrydilliadevicgfgrtgnlfgsqtfdmkpdilvmskqlsssylpisafl
    inervyapiaeeshkigtlgtgftasghpvaaavalenlaiieerdlvanardrgtymqk
    rlrelqdhplvgevrgvgliagvelvtdkqaktgleptgalgakanavlqergvisramg
    dtlafcppliindqqvdtmvsaleatlndvqasltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ghfB (B:)
    lviergdgiyvedvsgkryieamsglwsvgvgfseprlaeaaarqmkklpfyhtfsyrsh
    gpvidlaeklvsmapvpmskayftnsgseandtvvkliwyrsnalgeperkkiisrkrgy
    hgvtiasasltglpnnhrsfdlpidrilhtgcphfyregqageseeqfatrladeleqli
    iaegphtiaafigepvmgaggvvvppktywekvqavlkrydilliadevicgfgrtgnlf
    gsqtfdmkpdilvmskqlsssylpisaflinervyapiaeeshkigtlgtgftasghpva
    aavalenlaiieerdlvanardrgtymqkrlrelqdhplvgevrgvgliagvelvtdkqa
    ktgleptgalgakanavlqergvisramgdtlafcppliindqqvdtmvsaleatlndvq
    aslt