SCOPe 2.01: Domain d1yaga1: 1yag A:4-146

Lineage for d1yaga1 (1yag A:4-146)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries)

8. Domain d1yaga1: 1yag A:4-146 [33449]
   Other proteins in same PDB: d1yagg_
   complexed with atp, ca, mg, so4

Details for d1yaga1

PDB Entry: 1yag, 1.9 Å

PDB Description: structure of the yeast actin-human gelsolin segment 1 complex

PDB Compounds: (A:) protein (actin)

SCOPe Domain Sequences for d1yaga1:

Sequence; same for both SEQRES and ATOM records:

>d1yaga1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg
iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim
fetfnvpafyvsiqavlslyssg

Timeline for d1yaga1:

• d1yaga1 first appeared (with stable ids) in SCOP 1.55
  
• d1yaga1 appears in SCOP 1.75
  
• d1yaga1 appears in SCOPe 2.02
  
• d1yaga1 appears in the current release, SCOPe 2.08