Lineage for d1c0fa2 (1c0f A:147-375)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995079Protein Actin [53073] (6 species)
  7. 995211Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)
  8. 995219Domain d1c0fa2: 1c0f A:147-375 [33448]
    Other proteins in same PDB: d1c0fs_
    complexed with atp, ca

Details for d1c0fa2

PDB Entry: 1c0f (more details), 2.4 Å

PDB Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1c0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0fa2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d1c0fa2:

Click to download the PDB-style file with coordinates for d1c0fa2.
(The format of our PDB-style files is described here.)

Timeline for d1c0fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0fa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1c0fs_