| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Actin [53073] (6 species) |
| Species Dictyostelium discoideum [TaxId:44689] [53076] (6 PDB entries) |
| Domain d1c0fa1: 1c0f A:1-146 [33447] Other proteins in same PDB: d1c0fs_ |
PDB Entry: 1c0f (more details), 2.4 Å
SCOP Domain Sequences for d1c0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0fa1 c.55.1.1 (A:1-146) Actin {Dictyostelium discoideum [TaxId: 44689]}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg
Timeline for d1c0fa1: