Lineage for d1deja2 (1dej A:147-375)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372367Protein Actin [53073] (7 species)
  7. 1372526Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)
  8. 1372538Domain d1deja2: 1dej A:147-375 [33446]
    Other proteins in same PDB: d1dejs_
    dictyostelium/tetrahymena chimera
    complexed with atp, ca; mutant

Details for d1deja2

PDB Entry: 1dej (more details), 2.4 Å

PDB Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1
PDB Compounds: (A:) chimeric actin

SCOPe Domain Sequences for d1deja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deja2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemkaykessaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskheydesgpsivhrkcf

SCOPe Domain Coordinates for d1deja2:

Click to download the PDB-style file with coordinates for d1deja2.
(The format of our PDB-style files is described here.)

Timeline for d1deja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1deja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1dejs_