Lineage for d1deja1 (1dej A:1-146)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171385Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)
  8. 1171396Domain d1deja1: 1dej A:1-146 [33445]
    Other proteins in same PDB: d1dejs_
    dictyostelium/tetrahymena chimera
    complexed with atp, ca; mutant

Details for d1deja1

PDB Entry: 1dej (more details), 2.4 Å

PDB Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1
PDB Compounds: (A:) chimeric actin

SCOPe Domain Sequences for d1deja1:

Sequence, based on SEQRES records: (download)

>d1deja1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqs
krgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmt
qimfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1deja1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d1deja1:

Click to download the PDB-style file with coordinates for d1deja1.
(The format of our PDB-style files is described here.)

Timeline for d1deja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1deja2
View in 3D
Domains from other chains:
(mouse over for more information)
d1dejs_