SCOPe 2.08: Domain d5x52b2: 5x52 B:197-388

Lineage for d5x52b2 (5x52 B:197-388)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
   Uniprot P02768 29-596

8. Domain d5x52b2: 5x52 B:197-388 [334418]
   automated match to d3uiva1
   complexed with ame, oca, po4

Details for d5x52b2

PDB Entry: 5x52, 3.01 Å

PDB Description: human serum albumin complexed with octanoate and n-acetyl-l-methionine

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d5x52b2:

Sequence; same for both SEQRES and ATOM records:

>d5x52b2 a.126.1.1 (B:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d5x52b2:

• d5x52b2 first appeared in SCOPe 2.06
  
• d5x52b2 appears in SCOPe 2.07