Lineage for d5x52b1 (5x52 B:3-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013468Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2013469Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2013470Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
    Uniprot P02768 29-596
  8. 2013799Domain d5x52b1: 5x52 B:3-196 [334417]
    automated match to d3uiva1
    complexed with ame, oca, po4

Details for d5x52b1

PDB Entry: 5x52 (more details), 3.01 Å

PDB Description: human serum albumin complexed with octanoate and n-acetyl-l-methionine
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d5x52b1:

Sequence, based on SEQRES records: (download)

>d5x52b1 a.126.1.1 (B:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d5x52b1 a.126.1.1 (B:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlregemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

SCOPe Domain Coordinates for d5x52b1:

Click to download the PDB-style file with coordinates for d5x52b1.
(The format of our PDB-style files is described here.)

Timeline for d5x52b1: