Lineage for d1dgaa1 (1dga A:4-146)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124263Protein Actin [53073] (5 species)
  7. 124288Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (4 PDB entries)
  8. 124289Domain d1dgaa1: 1dga A:4-146 [33441]
    Other proteins in same PDB: d1dgag_

Details for d1dgaa1

PDB Entry: 1dga (more details), 1.93 Å

PDB Description: structure of dictyostelium discoideum actin complexed with mg atp and human gelsolin segment 1.

SCOP Domain Sequences for d1dgaa1:

Sequence, based on SEQRES records: (download)

>d1dgaa1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum)}
dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1dgaa1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum)}
dvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltlkyp
iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp
amyvaiqavlslyasg

SCOP Domain Coordinates for d1dgaa1:

Click to download the PDB-style file with coordinates for d1dgaa1.
(The format of our PDB-style files is described here.)

Timeline for d1dgaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dgaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1dgag_