Lineage for d1atna1 (1atn A:1-146)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124263Protein Actin [53073] (5 species)
  7. 124277Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (5 PDB entries)
  8. 124284Domain d1atna1: 1atn A:1-146 [33437]
    Other proteins in same PDB: d1atnd_

Details for d1atna1

PDB Entry: 1atn (more details), 2.8 Å

PDB Description: atomic structure of the actin:dnase i complex

SCOP Domain Sequences for d1atna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atna1 c.55.1.1 (A:1-146) Actin {Rabbit (Oryctolagus cuniculus)}
dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
qimfetfnvpamyvaiqavlslyasg

SCOP Domain Coordinates for d1atna1:

Click to download the PDB-style file with coordinates for d1atna1.
(The format of our PDB-style files is described here.)

Timeline for d1atna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1atna2
View in 3D
Domains from other chains:
(mouse over for more information)
d1atnd_