| Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) ![]() |
| Family c.55.1.1: Actin/HSP70 [53068] (6 proteins) |
| Protein Actin [53073] (5 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (5 PDB entries) |
| Domain d1atna1: 1atn A:1-146 [33437] Other proteins in same PDB: d1atnd_ |
PDB Entry: 1atn (more details), 2.8 Å
SCOP Domain Sequences for d1atna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atna1 c.55.1.1 (A:1-146) Actin {Rabbit (Oryctolagus cuniculus)}
dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
qimfetfnvpamyvaiqavlslyasg
Timeline for d1atna1: