SCOPe 2.01: Domain d1eqya1: 1eqy A:6-146

Lineage for d1eqya1 (1eqy A:6-146)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1eqya1: 1eqy A:6-146 [33435]
   Other proteins in same PDB: d1eqys_
   complexed with atp, ca

Details for d1eqya1

PDB Entry: 1eqy, 2.3 Å

PDB Description: complex between rabbit muscle alpha-actin: human gelsolin domain 1

PDB Compounds: (A:) alpha actin

SCOPe Domain Sequences for d1eqya1:

Sequence, based on SEQRES records:

>d1eqya1 c.55.1.1 (A:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe
tfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1eqya1 c.55.1.1 (A:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

Timeline for d1eqya1:

• d1eqya1 first appeared (with stable ids) in SCOP 1.55
  
• d1eqya1 appears in SCOP 1.75
  
• d1eqya1 appears in SCOPe 2.02
  
• d1eqya1 appears in the current release, SCOPe 2.08