Lineage for d1esva2 (1esv A:147-375)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171284Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1171338Domain d1esva2: 1esv A:147-375 [33434]
    Other proteins in same PDB: d1esvs_
    complexed with atp, ca, lar

Details for d1esva2

PDB Entry: 1esv (more details), 2 Å

PDB Description: complex between latrunculin a:rabbit muscle alpha actin:human gelsolin domain 1
PDB Compounds: (A:) alpha actin

SCOPe Domain Sequences for d1esva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esva2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d1esva2:

Click to download the PDB-style file with coordinates for d1esva2.
(The format of our PDB-style files is described here.)

Timeline for d1esva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1esva1
View in 3D
Domains from other chains:
(mouse over for more information)
d1esvs_