SCOP 1.59: Domain d1hlua2: 1hlu A:147-375

Lineage for d1hlua2 (1hlu A:147-375)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)

6. Protein Actin [53073] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (2 PDB entries)

8. Domain d1hlua2: 1hlu A:147-375 [33432]
   Other proteins in same PDB: d1hlup_

Details for d1hlua2

PDB Entry: 1hlu, 2.65 Å

PDB Description: structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible

SCOP Domain Sequences for d1hlua2:

Sequence; same for both SEQRES and ATOM records:

>d1hlua2 c.55.1.1 (A:147-375) Actin {Cow (Bos taurus)}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Timeline for d1hlua2:

• d1hlua2 first appeared (with stable ids) in SCOP 1.55
  
• d1hlua2 appears in SCOP 1.57
  
• d1hlua2 appears in SCOP 1.61
  
• d1hlua2 appears in the current release, SCOPe 2.08