Lineage for d2btfa1 (2btf A:2-146)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171264Species Cow (Bos taurus) [TaxId:9913] [53074] (5 PDB entries)
  8. 1171269Domain d2btfa1: 2btf A:2-146 [33429]
    Other proteins in same PDB: d2btfp_
    complexed with atp, sr

Details for d2btfa1

PDB Entry: 2btf (more details), 2.55 Å

PDB Description: the structure of crystalline profilin-beta-actin
PDB Compounds: (A:) beta-actin

SCOPe Domain Sequences for d2btfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btfa1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d2btfa1:

Click to download the PDB-style file with coordinates for d2btfa1.
(The format of our PDB-style files is described here.)

Timeline for d2btfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2btfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2btfp_