Lineage for d2btfa1 (2btf A:2-146)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124263Protein Actin [53073] (5 species)
  7. 124269Species Cow (Bos taurus) [TaxId:9913] [53074] (2 PDB entries)
  8. 124270Domain d2btfa1: 2btf A:2-146 [33429]
    Other proteins in same PDB: d2btfp_

Details for d2btfa1

PDB Entry: 2btf (more details), 2.55 Å

PDB Description: the structure of crystalline profilin-beta-actin

SCOP Domain Sequences for d2btfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btfa1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus)}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

SCOP Domain Coordinates for d2btfa1:

Click to download the PDB-style file with coordinates for d2btfa1.
(The format of our PDB-style files is described here.)

Timeline for d2btfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2btfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2btfp_