Lineage for d1hjoa1 (1hjo A:3-188)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488064Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 488157Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 488212Species Human (Homo sapiens) [TaxId:9606] [53071] (2 PDB entries)
  8. 488215Domain d1hjoa1: 1hjo A:3-188 [33425]

Details for d1hjoa1

PDB Entry: 1hjo (more details), 2.3 Å

PDB Description: ATPase domain of human heat shock 70kDa protein 1

SCOP Domain Sequences for d1hjoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjoa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens)}
kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldrt

SCOP Domain Coordinates for d1hjoa1:

Click to download the PDB-style file with coordinates for d1hjoa1.
(The format of our PDB-style files is described here.)

Timeline for d1hjoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hjoa2