Lineage for d5n6ga_ (5n6g A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437165Species Agrobacterium tumefaciens [TaxId:358] [197106] (5 PDB entries)
  8. 2437169Domain d5n6ga_: 5n6g A: [334217]
    automated match to d4jica_
    complexed with 8oz, act, fmn, gol

Details for d5n6ga_

PDB Entry: 5n6g (more details), 1.58 Å

PDB Description: nera from agrobacterium radiobacter in complex with 2-phenylacrylic acid
PDB Compounds: (A:) GTN Reductase

SCOPe Domain Sequences for d5n6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n6ga_ c.1.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tslfepaqagdialanrivmapltrnrspgaipnnlnatyyeqrataglivtegtpisqq
gqgyadvpglykreaiegwkkitdgvhsaggkivaqiwhvgrishtslqphggqpvapsa
itaksktyiinddgtgafaetsepraltiddigliledyrsgaraaleagfdgveihaan
gylieqflksstnqrtddyggsienrarfllevvdavaeeigagrtgirlspvtpandif
eadpqplynyvveqlgkrnlafihvvegatggprdfkqgdkpfdyasfkaayrnaggkgl
wianngydrqsaieavesgkvdavafgkafianpdlvrrlkndaplnapnqptfygggae
gytdypala

SCOPe Domain Coordinates for d5n6ga_:

Click to download the PDB-style file with coordinates for d5n6ga_.
(The format of our PDB-style files is described here.)

Timeline for d5n6ga_: