SCOPe 2.07: Domain d5n21b_: 5n21 B:

Lineage for d5n21b_ (5n21 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (33 PDB entries)

8. Domain d5n21b_: 5n21 B: [334216]
   automated match to d1r29a_
   complexed with 8hn, cl

Details for d5n21b_

PDB Entry: 5n21, 1.58 Å

PDB Description: crystal structure of the bcl6 btb domain in complex with pyrazolo- pyrimidine ligand

PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d5n21b_:

Sequence; same for both SEQRES and ATOM records:

>d5n21b_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

Timeline for d5n21b_:

• d5n21b_ first appeared in SCOPe 2.06
  
• d5n21b_ appears in the current release, SCOPe 2.08