SCOP 1.63: Domain d1ngg_1: 1ngg 3-188

Lineage for d1ngg_1 (1ngg 3-188)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1ngg_1: 1ngg 3-188 [33415]

Details for d1ngg_1

PDB Entry: 1ngg, 2.43 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

SCOP Domain Sequences for d1ngg_1:

Sequence; same for both SEQRES and ATOM records:

>d1ngg_1 c.55.1.1 (3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
kgpavgislgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk

Timeline for d1ngg_1:

• d1ngg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ngg_1 appears in SCOP 1.61
  
• d1ngg_1 appears in SCOP 1.65
  
• d1ngg_1 appears in the current release, SCOPe 2.08, called d1ngga1