SCOP 1.67: Domain d3hsc_2: 3hsc 189-384

Lineage for d3hsc_2 (3hsc 189-384)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d3hsc_2: 3hsc 189-384 [33400]
   complexed with adp, mg, na, po4

Details for d3hsc_2

PDB Entry: 3hsc, 1.9 Å

PDB Description: three-dimensional structure of the atpase fragment of a 70k heat-shock cognate protein

SCOP Domain Sequences for d3hsc_2:

Sequence; same for both SEQRES and ATOM records:

>d3hsc_2 c.55.1.1 (189-384) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaailsgdk

Timeline for d3hsc_2:

• d3hsc_2 first appeared (with stable ids) in SCOP 1.55
  
• d3hsc_2 appears in SCOP 1.65
  
• d3hsc_2 appears in SCOP 1.69
  
• d3hsc_2 appears in the current release, SCOPe 2.08, called d3hsca2