![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
![]() | Domain d5nqhd_: 5nqh D: [333981] automated match to d3dxda_ complexed with gol, so4 |
PDB Entry: 5nqh (more details), 2.6 Å
SCOPe Domain Sequences for d5nqhd_:
Sequence, based on SEQRES records: (download)
>d5nqhd_ b.55.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqte avlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlry qkcldars
>d5nqhd_ b.55.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvqkfqvyylgnvpvakpvgvdvingalesvlssreqwtpshvsvapatltilhqqteav lgecrvrflsflavgrdvhtfafimaapasfcchmfwcepnaaslseavqaacmlryqkc ldars
Timeline for d5nqhd_: