Lineage for d5nqhd_ (5nqh D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803915Domain d5nqhd_: 5nqh D: [333981]
    automated match to d3dxda_
    complexed with gol, so4

Details for d5nqhd_

PDB Entry: 5nqh (more details), 2.6 Å

PDB Description: structure of the human fe65-ptb2 homodimer
PDB Compounds: (D:) Amyloid beta A4 precursor protein-binding family B member 1

SCOPe Domain Sequences for d5nqhd_:

Sequence, based on SEQRES records: (download)

>d5nqhd_ b.55.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqte
avlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlry
qkcldars

Sequence, based on observed residues (ATOM records): (download)

>d5nqhd_ b.55.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvqkfqvyylgnvpvakpvgvdvingalesvlssreqwtpshvsvapatltilhqqteav
lgecrvrflsflavgrdvhtfafimaapasfcchmfwcepnaaslseavqaacmlryqkc
ldars

SCOPe Domain Coordinates for d5nqhd_:

Click to download the PDB-style file with coordinates for d5nqhd_.
(The format of our PDB-style files is described here.)

Timeline for d5nqhd_: