Lineage for d1kaxa1 (1kax A:4-188)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171431Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 1171432Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 1171451Domain d1kaxa1: 1kax A:4-188 [33389]
    complexed with atp, cl, k, mg; mutant

Details for d1kaxa1

PDB Entry: 1kax (more details), 1.7 Å

PDB Description: 70kd heat shock cognate protein atpase domain, k71m mutant
PDB Compounds: (A:) 70kd heat shock cognate protein

SCOPe Domain Sequences for d1kaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kaxa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdamrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOPe Domain Coordinates for d1kaxa1:

Click to download the PDB-style file with coordinates for d1kaxa1.
(The format of our PDB-style files is described here.)

Timeline for d1kaxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kaxa2