Lineage for d1kaz_1 (1kaz 4-188)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124310Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 124311Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 124322Domain d1kaz_1: 1kaz 4-188 [33383]

Details for d1kaz_1

PDB Entry: 1kaz (more details), 1.7 Å

PDB Description: 70kd heat shock cognate protein atpase domain, k71e mutant

SCOP Domain Sequences for d1kaz_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kaz_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdaerligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOP Domain Coordinates for d1kaz_1:

Click to download the PDB-style file with coordinates for d1kaz_1.
(The format of our PDB-style files is described here.)

Timeline for d1kaz_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kaz_2