|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)  duplication contains two domains of this fold | 
|  | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) | 
|  | Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) | 
|  | Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) | 
|  | Domain d1hpma2: 1hpm A:189-381 [33382] complexed with adp, cl, k, mg, po4 | 
PDB Entry: 1hpm (more details), 1.7 Å
SCOPe Domain Sequences for d1hpma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpma2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
Timeline for d1hpma2: