SCOP 1.65: Domain d2bupa1: 2bup A:4-188

Lineage for d2bupa1 (2bup A:4-188)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d2bupa1: 2bup A:4-188 [33379]

Details for d2bupa1

PDB Entry: 2bup, 1.7 Å

PDB Description: t13g mutant of the atpase fragment of bovine hsc70

SCOP Domain Sequences for d2bupa1:

Sequence; same for both SEQRES and ATOM records:

>d2bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlggtyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

Timeline for d2bupa1:

• d2bupa1 first appeared (with stable ids) in SCOP 1.55
  
• d2bupa1 appears in SCOP 1.63
  
• d2bupa1 appears in SCOP 1.67
  
• d2bupa1 appears in the current release, SCOPe 2.08