Lineage for d5jnad_ (5jna D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2077898Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2077899Protein Carbonic anhydrase [51071] (10 species)
  7. 2078648Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (9 PDB entries)
  8. 2078668Domain d5jnad_: 5jna D: [333730]
    automated match to d1znca_
    complexed with act, gol, so4, tor, zn

Details for d5jnad_

PDB Entry: 5jna (more details), 2 Å

PDB Description: crystal structure for the complex of human carbonic anhydrase iv and topiramate
PDB Compounds: (D:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5jnad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnad_ b.74.1.1 (D:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
vhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmae
sslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydke
qtvsmkdnvrplqqlgqrtviks

SCOPe Domain Coordinates for d5jnad_:

Click to download the PDB-style file with coordinates for d5jnad_.
(The format of our PDB-style files is described here.)

Timeline for d5jnad_: