Lineage for d5va8d1 (5va8 D:1-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456298Species Paraburkholderia phymatum [TaxId:391038] [333644] (2 PDB entries)
  8. 2456304Domain d5va8d1: 5va8 D:1-259 [333673]
    Other proteins in same PDB: d5va8a2, d5va8b2, d5va8c2, d5va8d2
    automated match to d5idxb_
    complexed with mpo, nap, tce

Details for d5va8d1

PDB Entry: 5va8 (more details), 1.6 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase sdr from burkholderia phymatum in complex with nadp
PDB Compounds: (D:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5va8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5va8d1 c.2.1.0 (D:1-259) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
mdlgiagksalvcaaskglgrgcaealaaegvnvtivartpetldataaairanagvdvq
avacdittpegraaalaacpqpdilvnnaggpppgdfrnfthddwiraleanmltpieli
ratidgmisrgfgrvvnitsssvkapidvlglsngarsgltgfiagvarkvapngvtinn
llpgifdtdriavtfdaaakaqnisvdearkqrmatiparrfgtpdefgracaflcsvha
gyitgqnwlidggaypgty

SCOPe Domain Coordinates for d5va8d1:

Click to download the PDB-style file with coordinates for d5va8d1.
(The format of our PDB-style files is described here.)

Timeline for d5va8d1: