![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [333625] (1 PDB entry) |
![]() | Domain d5x5wb_: 5x5w B: [333639] automated match to d1neua_ |
PDB Entry: 5x5w (more details), 2.7 Å
SCOPe Domain Sequences for d5x5wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x5wb_ b.1.1.0 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvm
Timeline for d5x5wb_: