SCOPe 2.07: Domain d5x5wb_: 5x5w B:

Lineage for d5x5wb_ (5x5w B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [333625] (1 PDB entry)

8. Domain d5x5wb_: 5x5w B: [333639]
   automated match to d1neua_

Details for d5x5wb_

PDB Entry: 5x5w, 2.7 Å

PDB Description: crystal structure of pseudorabies virus glycoprotein d

PDB Compounds: (B:) Nectin-1

SCOPe Domain Sequences for d5x5wb_:

Sequence; same for both SEQRES and ATOM records:

>d5x5wb_ b.1.1.0 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer
veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvm

Timeline for d5x5wb_:

• d5x5wb_ first appeared in SCOPe 2.06
  
• d5x5wb_ appears in the current release, SCOPe 2.08