SCOPe 2.07: Domain d5tifa1: 5tif A:2-181

Lineage for d5tifa1 (5tif A:2-181)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.5: TAP-like [89594] (3 proteins)
   automatically mapped to Pfam PF00657
   automatically mapped to Pfam PF13472

6. Protein automated matches [333488] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [333489] (6 PDB entries)

8. Domain d5tifa1: 5tif A:2-181 [333601]
   Other proteins in same PDB: d5tifa2
   automated match to d1ivna_
   complexed with oca, peg; mutant

Details for d5tifa1

PDB Entry: 5tif, 0.97 Å

PDB Description: x-ray structure of acyl-coa thioesterase i, tesa, triple mutant m141l/y145k/l146k in complex with octanoic acid

PDB Compounds: (A:) Acyl-CoA Thioesterase I

SCOPe Domain Sequences for d5tifa1:

Sequence; same for both SEQRES and ATOM records:

>d5tifa1 c.23.10.5 (A:2-181) automated matches {Escherichia coli [TaxId: 562]}
dtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
saiypklakefdvpllpffleevkkkpqwmqddgihpnrdaqpfiadwmakqlqplvnhd

Timeline for d5tifa1:

• d5tifa1 first appeared in SCOPe 2.06
  
• d5tifa1 appears in the current release, SCOPe 2.08