Lineage for d1xo1b2 (1xo1 B:19-185)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011866Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1011867Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 1011923Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1011951Protein T5 5'-exonuclease [53050] (1 species)
  7. 1011952Species Bacteriophage T5 [TaxId:10726] [53051] (4 PDB entries)
  8. 1011954Domain d1xo1b2: 1xo1 B:19-185 [33357]
    Other proteins in same PDB: d1xo1a1, d1xo1b1
    mutant

Details for d1xo1b2

PDB Entry: 1xo1 (more details), 2.5 Å

PDB Description: t5 5'-exonuclease mutant k83a
PDB Compounds: (B:) 5'-exonuclease

SCOPe Domain Sequences for d1xo1b2:

Sequence, based on SEQRES records: (download)

>d1xo1b2 c.120.1.2 (B:19-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrleh
lpeyagnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivk
lighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

Sequence, based on observed residues (ATOM records): (download)

>d1xo1b2 c.120.1.2 (B:19-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rrnlmivdgtnlgfrfpfassyvstiqslaksysarttivlgdkgksvfrlehlpeyaff
eylkdafelckttfptftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvs
rfsfttrreyhlrdmyehhn

SCOPe Domain Coordinates for d1xo1b2:

Click to download the PDB-style file with coordinates for d1xo1b2.
(The format of our PDB-style files is described here.)

Timeline for d1xo1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xo1b1