| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
| Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
| Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species) |
| Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries) |
| Domain d1taua2: 1tau A:10-173 [33355] Other proteins in same PDB: d1taua1, d1taua3, d1taua4 protein/DNA complex; complexed with bgl, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1tau (more details), 3 Å
SCOPe Domain Sequences for d1taua2:
Sequence, based on SEQRES records: (download)
>d1taua2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg
>d1taua2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg
Timeline for d1taua2: