Lineage for d5lbha_ (5lbh A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991738Species Helicobacter cinaedi [TaxId:213] [333401] (1 PDB entry)
  8. 1991739Domain d5lbha_: 5lbh A: [333526]
    automated match to d2fjcc_
    complexed with fe

Details for d5lbha_

PDB Entry: 5lbh (more details), 2.55 Å

PDB Description: crystal structure of helicobacter cinaedi caip
PDB Compounds: (A:) caip

SCOPe Domain Sequences for d5lbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lbha_ a.25.1.0 (A:) automated matches {Helicobacter cinaedi [TaxId: 213]}
kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
aayaddkvgelqkaiwmlksqla

SCOPe Domain Coordinates for d5lbha_:

Click to download the PDB-style file with coordinates for d5lbha_.
(The format of our PDB-style files is described here.)

Timeline for d5lbha_: