Lineage for d1fzra_ (1fzr A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245698Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 245699Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families) (S)
  5. 245864Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)
  6. 245865Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
    forms dimer by swapping the common core elements
  7. 245866Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)
  8. 245871Domain d1fzra_: 1fzr A: [33336]

Details for d1fzra_

PDB Entry: 1fzr (more details), 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i

SCOP Domain Sequences for d1fzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzra_ c.52.1.17 (A:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOP Domain Coordinates for d1fzra_:

Click to download the PDB-style file with coordinates for d1fzra_.
(The format of our PDB-style files is described here.)

Timeline for d1fzra_: