SCOPe 2.04: Domain d2azob_: 2azo B:

Lineage for d2azob_ (2azo B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (2 proteins)

6. Protein DNA mismatch repair protein MutH from [53021] (1 species)

7. Species Escherichia coli [TaxId:562] [53022] (2 PDB entries)

8. Domain d2azob_: 2azo B: [33331]

Details for d2azob_

PDB Entry: 2azo, 2.3 Å

PDB Description: dna mismatch repair protein muth from e. coli

PDB Compounds: (B:) muth

SCOPe Domain Sequences for d2azob_:

Sequence; same for both SEQRES and ATOM records:

>d2azob_ c.52.1.14 (B:) DNA mismatch repair protein MutH from {Escherichia coli [TaxId: 562]}
qprpllsppeteeqllaqaqqlsgytlgelaalvglvtpenlkrdkgwigvlleiwlgas
agskpeqdfaalgvelktipvdslgrplettfvcvapltgnsgvtwetshvrhklkrvlw
ipvegersiplaqrrvgspllwspneeedrqlredweelmdmivlgqveritarhgeylq
irpkaanakalteaigargeriltlprgfylkknftsallarhfliq

Timeline for d2azob_:

• d2azob_ first appeared (with stable ids) in SCOP 1.55
  
• d2azob_ appears in SCOPe 2.03
  
• d2azob_ appears in SCOPe 2.05
  
• d2azob_ appears in the current release, SCOPe 2.08