SCOPe 2.07: Domain d5tnwb1: 5tnw B:663-758

Lineage for d5tnwb1 (5tnw B:663-758)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Phospholipase C-gamma-1 [55577] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55578] (5 PDB entries)

8. Domain d5tnwb1: 5tnw B:663-758 [333283]
   Other proteins in same PDB: d5tnwa2, d5tnwb2
   automated match to d1qada_

Details for d5tnwb1

PDB Entry: 5tnw, 1.4 Å

PDB Description: phospholipase c gamma-1 c-terminal sh2 domain

PDB Compounds: (B:) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1

SCOPe Domain Sequences for d5tnwb1:

Sequence; same for both SEQRES and ATOM records:

>d5tnwb1 d.93.1.1 (B:663-758) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]}
heskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvqqegq
tvmlgnsefdslvdlisyyekhplyrkmklrypine

Timeline for d5tnwb1:

• d5tnwb1 first appeared in SCOPe 2.06
  
• d5tnwb1 appears in the current release, SCOPe 2.08