Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Phospholipase C-gamma-1 [55577] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [55578] (5 PDB entries) |
Domain d5tnwb1: 5tnw B:663-758 [333283] Other proteins in same PDB: d5tnwa2, d5tnwb2 automated match to d1qada_ |
PDB Entry: 5tnw (more details), 1.4 Å
SCOPe Domain Sequences for d5tnwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tnwb1 d.93.1.1 (B:663-758) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} heskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvqqegq tvmlgnsefdslvdlisyyekhplyrkmklrypine
Timeline for d5tnwb1: