Lineage for d1avqc_ (1avq C:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245698Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 245699Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families) (S)
  5. 245842Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 245843Protein lambda exonuclease [53018] (1 species)
  7. 245844Species Bacteriophage lambda [TaxId:10710] [53019] (1 PDB entry)
  8. 245847Domain d1avqc_: 1avq C: [33328]
    complexed with act, po4; mutant

Details for d1avqc_

PDB Entry: 1avq (more details), 2.4 Å

PDB Description: toroidal structure of lambda exonuclease determined at 2.4 angstroms

SCOP Domain Sequences for d1avqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avqc_ c.52.1.13 (C:) lambda exonuclease {Bacteriophage lambda}
tpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfhtl
laevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdgl
csdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmkr
eglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOP Domain Coordinates for d1avqc_:

Click to download the PDB-style file with coordinates for d1avqc_.
(The format of our PDB-style files is described here.)

Timeline for d1avqc_: