Lineage for d1avqb_ (1avq B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994595Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 994596Protein lambda exonuclease [53018] (1 species)
  7. 994597Species Bacteriophage lambda [TaxId:10710] [53019] (2 PDB entries)
  8. 994599Domain d1avqb_: 1avq B: [33327]
    complexed with act, po4

Details for d1avqb_

PDB Entry: 1avq (more details), 2.4 Å

PDB Description: toroidal structure of lambda exonuclease determined at 2.4 angstroms
PDB Compounds: (B:) lambda exonuclease

SCOPe Domain Sequences for d1avqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avqb_ c.52.1.13 (B:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
shmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyf
htllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacsp
dglcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydpr
mkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOPe Domain Coordinates for d1avqb_:

Click to download the PDB-style file with coordinates for d1avqb_.
(The format of our PDB-style files is described here.)

Timeline for d1avqb_: