![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) ![]() |
![]() | Family c.52.1.12: Restriction endonuclease FokI, C-terminal (catalytic) domain [53014] (1 protein) automatically mapped to Pfam PF09254 |
![]() | Protein Restriction endonuclease FokI, C-terminal (catalytic) domain [53015] (1 species) |
![]() | Species Flavobacterium okeanokoites [TaxId:244] [53016] (2 PDB entries) |
![]() | Domain d2fokb4: 2fok B:387-579 [33324] Other proteins in same PDB: d2foka1, d2foka2, d2foka3, d2fokb1, d2fokb2, d2fokb3 |
PDB Entry: 2fok (more details), 2.3 Å
SCOPe Domain Sequences for d2fokb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fokb4 c.52.1.12 (B:387-579) Restriction endonuclease FokI, C-terminal (catalytic) domain {Flavobacterium okeanokoites [TaxId: 244]} kseleekkselrhklkyvpheyielieiarnstqdrilemkvmeffmkvygyrgkhlggs rkpdgaiytvgspidygvivdtkaysggynlpigqademqryveenqtrnkhinpnewwk vypssvtefkflfvsghfkgnykaqltrlnhitncngavlsveelliggemikagtltle evrrkfnngeinf
Timeline for d2fokb4:
![]() Domains from other chains: (mouse over for more information) d2foka1, d2foka2, d2foka3, d2foka4 |